Host taxon 10090
Protein NP_001028646.2
ataxin-7-like protein 3B
Mus musculus
Gene Atxn7l3b, UniProt Q3UD01
>NP_001028646.2|Yersinia pseudotuberculosis IP 32953|ataxin-7-like protein 3B
MEEISLANLDTNKLEAIAQEIYVDLIEDSCLGFCFEVHRAVKCGYFYLEFADTGSVKDFGIQPVEDKGACRLPLCSLPGDPGDGPQTELQRSPPEFQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.61 | -0.607313237550599 | 0.0097 | 28096329 | |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)