Host taxon 10090
Protein NP_082415.2
ataxin-7-like protein 1 isoform 2
Mus musculus
Gene Atxn7l1, UniProt Q9CZ05
>NP_082415.2|Yersinia pseudotuberculosis IP 32953|ataxin-7-like protein 1 isoform 2
MTSERSRIPCLSAAAAEGTGKKQQEGTAMATLHRKVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKEDMHLFGHYPAHDDFYLVVCSACNQVVKPQVFQSHCGRKQDSKRNASISWSGAESRQALEQRQV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.61 | 0.60708895912413 | 0.0012 | 28096329 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)