Host taxon 10090
Protein NP_076154.3
arginine/serine-rich protein 1
Mus musculus
Gene Rsrp1, UniProt Q3UC65
>NP_076154.3|Yersinia pseudotuberculosis IP 32953|arginine/serine-rich protein 1
MSSAAMSKYVNDMWPGSPQEKASPSTSGSGRSSRLSSRSRSRSSSRSSRRDSRSSSRSSSRSHSRPRRSRRSRSRSRRRHQRKYRRYSRSYSRSRSRSRSHRYHRDSRYERPRRYYKSPSPYRSRSRSRSRGRSQHRWSYYAITRGRRYYGFGRTVYPEDRPRWRERSRTRSRSRSRTPFRLSEKDRMELLEIAKANAAKALGTANFDLPASLRAKEASQGTAVSSSGPKVEHSEKQTEDATKNTSEKSSTQRNIAFSSNNSVAKPLQKTTKAAVEEKSSGSPKIDKKKSPYGLWIPV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.94 | 0.940041893481304 | 0.00061 | 28096329 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)