Host taxon 10090
Protein NP_033871.2
apoptosis regulator Bcl-2 isoform 1
Mus musculus
Gene Bcl2, UniProt P10417
>NP_033871.2|Yersinia pseudotuberculosis IP 32953|apoptosis regulator Bcl-2 isoform 1
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.64 | 0.636740168070948 | 0.031 | 28096329 | |
Retrieved 1 of 3 entries in 0.6 ms
(Link to these results)