Host taxon 10090
Protein NP_001276685.1
apolipoprotein C-III isoform b precursor
Mus musculus
Gene Apoc3, UniProt P33622
>NP_001276685.1|Yersinia pseudotuberculosis IP 32953|apolipoprotein C-III isoform b precursor
MQPRTLLTVALLALLASARAEEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRSLKGYWSKFTDKFTGFWDSNPEDQPTPAIES
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● -5.15 | -5.14850981148699 | 4.1e-82 | 28096329 | |
Retrieved 1 of 3 entries in 0.7 ms
(Link to these results)