Host taxon 10090
Protein NP_033811.1
AP-3 complex subunit sigma-1 isoform 1
Mus musculus
Gene Ap3s1, UniProt Q9DCR2
>NP_033811.1|Yersinia pseudotuberculosis IP 32953|AP-3 complex subunit sigma-1 isoform 1
MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHNILAEMVMGGMVLETNMNEIVTQIDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLPSFK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.11 | 1.10989199461287 | 0.012 | 28096329 | |
Retrieved 1 of 3 entries in 0.7 ms
(Link to these results)