Host taxon 10090
Protein NP_001277307.1
AP-1 complex subunit sigma-2 isoform 2
Mus musculus
Gene Ap1s2, UniProt Q9DB50
>NP_001277307.1|Yersinia pseudotuberculosis IP 32953|AP-1 complex subunit sigma-2 isoform 2
MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.6 | 1.60006160270571 | 3.3e-6 | 28096329 | |
Retrieved 1 of 3 entries in 1.1 ms
(Link to these results)