Host taxon 10090
Protein NP_035544.1
antileukoproteinase precursor
Mus musculus
Gene Slpi, UniProt P97430
>NP_035544.1|Yersinia pseudotuberculosis IP 32953|antileukoproteinase precursor
MKSCGLLPFTVLLALGILAPWTVEGGKNDAIKIGACPAKKPAQCLKLEKPQCRTDWECPGKQRCCQDACGSKCVNPVPIRKPVWRKPGRCVKTQARCMMLNPPNVCQRDGQCDGKYKCCEGICGKVCLPPM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.63 | 1.63009617001464 | 4.2e-16 | 28096329 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)