Host taxon 10090
Protein NP_035913.1
anterior gradient protein 2 homolog precursor
Mus musculus
Gene Agr2, UniProt O88312
>NP_035913.1|Yersinia pseudotuberculosis IP 32953|anterior gradient protein 2 homolog precursor
MEKFSVSAILLLVAISGTLAKDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.9 | -0.897843041614132 | 4.6e-5 | 28096329 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)