Host taxon 10090
Protein NP_001139347.1
androgen-dependent TFPI-regulating protein isoform 2
Mus musculus
Gene Adtrp, UniProt Q8C138
>NP_001139347.1|Yersinia pseudotuberculosis IP 32953|androgen-dependent TFPI-regulating protein isoform 2
MTKTTTCVYHFLVLNWYIFLNYHIPQIGRNEEKLREFHDGGRSKYLTLLNLLLQAIFFGVACLDDVLKRVIGRKDIKFVTSFRDLLFTTMAFPISTFVFLVFWTLFHYDRSLVYPKGLDDFFPAWVNHAMHTSIFPFSLFETILRPHNYPSKKLGLTLLGAFNFAYIIRILWRYVQTGNWVYPVFDSLSPLGIIIFFSAAYILVAGIYLFGEKINHWKWGAIAKPQMKKN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.68 | -1.67635438322419 | 8.0e-6 | 28096329 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)