Host taxon 10090
Protein NP_001033319.1
anaphase-promoting complex subunit 11
Mus musculus
Gene Anapc11, UniProt Q9CPX9
>NP_001033319.1|Yersinia pseudotuberculosis IP 32953|anaphase-promoting complex subunit 11
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLNAQQVQQHCPMCRQEWKFKE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.68 | 0.68358204352384 | 0.012 | 28096329 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)