Host taxon 10090
Protein NP_079814.1
alpha-ketoglutarate-dependent dioxygenase alkB homolog 7, mitochondrial isoform 1 precursor
Mus musculus
Gene Alkbh7, UniProt Q9D6Z0
>NP_079814.1|Yersinia pseudotuberculosis IP 32953|alpha-ketoglutarate-dependent dioxygenase alkB homolog 7, mitochondrial isoform 1 precursor
MAGSRRLAMRLLSGCAWVRGSDSAVLGRLRDEAVVHPGFLSQEEEDTLTRELEPQLRRRRYEYDHWDAAIHGFRETEKSCWSDASQVILQRVRAAAFGPDQSLLSPVHVLDLEPRGYIKPHVDSVKFCGSTIAGLSLLSPSVMKLVHTQEPEQWLELLLEPGSLYILRGSARYDFSHEILRDEESFFGEHRVPRGRRISVICRSLPEGMGPGRPEEPPPAC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.35 | -1.34923135442856 | 0.00034 | 28096329 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)