Host taxon 10090
Protein NP_001019396.1
alpha-defensin 24 precursor
Mus musculus
Gene Defa24, UniProt Q5G865
>NP_001019396.1|Yersinia pseudotuberculosis IP 32953|alpha-defensin 24 precursor
MKTLILLSALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGASLQEESLRDLVCYCRARGCKGRERMNGTCSKGHLLYMLCCR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ -3.12 | -3.11886361551901 | 2.7e-43 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)