Host taxon 10090
Protein NP_997541.2
alpha-defensin 22 precursor
Mus musculus
Gene Defa22, UniProt Q8C1N8
>NP_997541.2|Yersinia pseudotuberculosis IP 32953|alpha-defensin 22 precursor
MKTLVLLSALILLAYQVQTDPIQNTDEETNTEEQPGEEDQAVSVSFGGQEGSALHEKLSRDLICLCRKRRCNRGELFYGTCAGPFLRCCRRRR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.39 | -2.39337004320575 | 0.033 | 28096329 | |
Retrieved 1 of 2 entries in 0.6 ms
(Link to these results)