Host taxon 10090
Protein NP_035146.1
alpha-1-acid glycoprotein 2 precursor
Mus musculus
Gene Orm2, UniProt P07361
>NP_035146.1|Yersinia pseudotuberculosis IP 32953|alpha-1-acid glycoprotein 2 precursor
MALHMILVMVSLLPLLEAQNPEHVNITIGDPITNETLSWLSDKWFFIGAAVLNPDYRQEIQKTQMVFFNLTPNLINDTMELREYHTIDDHCVYNSTHLGIQRENGTLSKYVGGVKIFADLIVLKMHGAFMLAFDLKDEKKRGLSLNAKRPDITPELREVFQKAVTHVGMDESEIIFVDWKKDRCSQQEKQQLELEKETKKDPEEGQA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.12 | 2.11743993902572 | 0.00022 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)