Host taxon 10090
Protein NP_032794.1
alpha-1-acid glycoprotein 1 precursor
Mus musculus
Gene Orm1, UniProt Q60590
>NP_032794.1|Yersinia pseudotuberculosis IP 32953|alpha-1-acid glycoprotein 1 precursor
MALHTVLIILSLLPMLEAQNPEHANFTIGEPITNETLSWLSDKWFFMGAAFRKLEYRQAIQTMQSEFFYLTTNLINDTIELRESQTIGDQCVYNSTHLGFQRENGTFSKYEGGVETFAHLIVLRKHGAFMLAFDLKDEKKRGLSLYAKRPDITPELREVFQKAVTHVGMDESEIIFVDWKKDRCGQQEKKQLELGKETKKDPEEGQA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 4.69 | 4.69044873354357 | 3.9e-9 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)