Host taxon 10090
Protein NP_038805.2
aldo-keto reductase family 1, member C12
Mus musculus
Gene Akr1c12, UniProt Q9JLI0
>NP_038805.2|Yersinia pseudotuberculosis IP 32953|aldo-keto reductase family 1, member C12
MSSKQHYVKLNDGHLIPALGFGTYKPKEVPKSKSLEAACLALDVGYRHVDTAYAYQVEEEIGQAIQSKIKAGVVKREDLFITTKLWCGCFRPELVKPALEKSLKSLQLDYVDLYLIHYPVPMKPGDNESPLDENGKFLLDTVDFCDTWERLEECKDAGLVKSIGVSNFNHRQLERILNKPGLKYKPVCNQVECHLYLNQSKLLDYCKSKDIVLVAYGALGTQRYKEWVDQNSPVLLNDPVLCDVAKRNKRSPALIALRYLFQRGIVPLAQSFKENEMRENLQVFEFQLSPEDMKTLDGLNKNFRYLPAEFLADHPEYPFSEEY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.08 | -2.08071045380396 | 6.5e-10 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)