Host taxon 10090
Protein NP_081099.1
ADP-ribosylation factor-like protein 8A
Mus musculus
Gene Arl8a, UniProt Q8VEH3
>NP_081099.1|Yersinia pseudotuberculosis IP 32953|ADP-ribosylation factor-like protein 8A
MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLAGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.67 | 0.667140109274023 | 0.0014 | 28096329 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)