Host taxon 10090
Protein NP_083742.3
ADP-ribosylation factor-like protein 5B
Mus musculus
Gene Arl5b, UniProt Q9D4P0
>NP_083742.3|Yersinia pseudotuberculosis IP 32953|ADP-ribosylation factor-like protein 5B
MGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRIGVR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.7 | 0.695063877377246 | 0.017 | 28096329 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)