Host taxon 10090
Protein NP_796311.2
ADP-ribosylation factor-like protein 11
Mus musculus
Gene Arl11, UniProt Q6P3A9
>NP_796311.2|Yersinia pseudotuberculosis IP 32953|ADP-ribosylation factor-like protein 11
MGSVNSRGHKAEAQVVMMGLDSAGKTTILYKLKGNQLVDTLPTVGFNVEPLEAPGHVSLTLWDIGGQTQLRATWKDYLEGIDLLVYVLDSTDEARLPEAVAELKEVLEDPNMAGVPFLVLANKQEAPGALPLLEIRNRLGLEGFQKHCWELRACSALTGQGLQEALQSLLHLLKSR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.52 | 1.51584311962098 | 0.00067 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)