Host taxon 10090
Protein NP_083817.1
adipocyte-related X-chromosome expressed sequence 1
Mus musculus
Gene Arxes2, UniProt C0HK80
>NP_083817.1|Yersinia pseudotuberculosis IP 32953|adipocyte-related X-chromosome expressed sequence 1
MNSLLSRANSLFAFTLSVMAALTLGCILTTAFKDRSAPVRLHVSRILLKKVEDFTGPRKKSDLGFITFHISADLEKTFDWNVKQLFLYLSAEYSTKSNAVNQVVLWDKILLRGENPKLNLKDVKSKYFFFDDGHGLKGNRNVTLTLSWQVIPIAGILPLVTGSGRVSVPFPDSYEIATTF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.67 | 2.67274036487547 | 0.0047 | 28096329 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)