Host taxon 10090
Protein NP_001268783.1
acyloxyacyl hydrolase isoform 2 preproprotein
Mus musculus
Gene Aoah, UniProt O35298
>NP_001268783.1|Yersinia pseudotuberculosis IP 32953|acyloxyacyl hydrolase isoform 2 preproprotein
MKFPWKVFKTTLLLLLLSHSLASVPSEDQPGDSYSHGQSCLGCVVLVSVIEQLAEVHNSSVQVAMERLCSYLPEKLFLKTACYFLVQTFGSDIIKLLDEAMKADVVCYALEFCKRGAVQPQCHLYPLPQDNQLISRCPERFRDQY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.43 | 1.42539649333736 | 0.00012 | 28096329 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)