Host taxon 10090
Protein NP_062798.1
actin-related protein 2/3 complex subunit 3
Mus musculus
Gene Arpc3, UniProt Q9JM76
>NP_062798.1|Yersinia pseudotuberculosis IP 32953|actin-related protein 2/3 complex subunit 3
MPAYHSSLMDPDTKLIGNMALLPLRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPASKQEDEMMRAYLQQLRQETGLRLCEKVFDPQSDKPSKWWTCFVKRQFMNKSLSGPGQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.57 | 0.573060470284757 | 0.0077 | 28096329 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)