Host taxon 10090
Protein NP_033802.2
acidic leucine-rich nuclear phosphoprotein 32 family member A
Mus musculus
Gene Anp32a, UniProt O35381
>NP_033802.2|Yersinia pseudotuberculosis IP 32953|acidic leucine-rich nuclear phosphoprotein 32 family member A
MEMDKRIYLELRNRTPSDVKELVLDNCKSIEGKIEGLTDEFEELEFLSTINVGLTSISNLPKLNKLKKLELSENRISGDLEVLAEKCPNLKHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNAYRENVFKLLPQVMYLDGYDRDNKEAPDSDVEGYVEDDDEEDEDEEEYDEYAQLVEDEEEEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEEAGEEEGSQKRKREPDDEGEEDD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.71 | 0.706428884594411 | 0.03 | 28096329 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)