Bacterial taxon 273123
Protein WP_002208618.1
50S ribosomal protein L36
Yersinia pseudotuberculosis IP 32953
Gene rpmJ2, UniProt Q66DR2
>WP_002208618.1|Yersinia pseudotuberculosis IP 32953|50S ribosomal protein L36
MQVLSSLRSAKNRHPDCKIVRRRGRVYVICKSNPRFKAVQGGTHKKR
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 8,66 | 8.65601444787415 | 1,1e-59 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 7,47 | 7.47084150933722 | 6,5e-42 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 7,23 | 7.22817931410763 | 1,9e-68 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 6,86 | 6.86167129571815 | 2,3e-49 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Retrieved 4 of 1 entries in 2,2 ms
(Link to these results)