Bacterial taxon 273123
Protein WP_002213341.1
50S ribosomal protein L15
Yersinia pseudotuberculosis IP 32953
Gene rplO, UniProt Q664U0
>WP_002213341.1|Yersinia pseudotuberculosis IP 32953|50S ribosomal protein L15
MRLNTLSPAEGAKHAPKRVGRGIGSGLGKTAGRGHKGQNSRSGGGVRRGFEGGQMPLYRRLPKFGFTSRKAMITAEVRLSELALVEGDVIDLNTLKAANVVGIQMEFVKVILSGEVNRAVTLRGLRVTKGARAAIEAAGGKIEE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.17 | -3.16948507385378 | 9.0e-29 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.37 | 2.36513623109683 | 2.9e-6 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.14 | 2.13583589556817 | 1.1e-8 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.77 | -1.7729952669791 | 3.7e-6 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 4 of 1 entries in 2 ms
(Link to these results)