Bacterial taxon 273123
Protein WP_002210673.1
50S ribosomal protein L1
Yersinia pseudotuberculosis IP 32953
Gene rplA, UniProt Q66FQ5
>WP_002210673.1|Yersinia pseudotuberculosis IP 32953|50S ribosomal protein L1
MAKLTKRMRVIRDKVDVTKQYDINEAVALLKELATAKFVESVDVAVNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFAQGANAEAAKEAGAELVGMDDLADQIKKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRYRNDKNGIIHTTIGKVDFDSDKLKENLESLVVALKKAKPATAKGIYIKKISLSTTMGAGVAIDQSGLTAVVN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.85 | -2.84666969751114 | 7.3e-64 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.8 | -1.8033877980816 | 4.7e-9 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.62 | 1.61631048564992 | 2.6e-6 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.34 | 1.34113155819126 | 1.0e-8 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Retrieved 4 of 1 entries in 1.9 ms
(Link to these results)