Host taxon 10090
Protein NP_001041611.1
5-azacytidine-induced protein 2 isoform b
Mus musculus
Gene Azi2, UniProt Q9QYP6
>NP_001041611.1|Yersinia pseudotuberculosis IP 32953|5-azacytidine-induced protein 2 isoform b
MDTLVEDDICILNHEKAHRREAVTPLSAYPGDESVASHFALVTAYEDIKKRLKDSEKENSFLKKRIRALEERLVGARADEETSSVGREQVNKAYHAYREVCIDRDNLKNQLEKINKDNSESLKMLNEQLQSKEVELLQLRTEVETQQVMRNLNPPSSSWEVEKLSCDLKIHGLEQELGLLRKECSDLRTELQKARQTGPPQEDILQGRDVIRPSLSREEHVPHQGLHHSDNMQHAYWELKREMSNLHLVTQVQAELLRKLKTSAAVKKGKSLLAANADSSQTA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.72 | 0.719191452282381 | 0.00039 | 28096329 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)