Host taxon 10090
Protein NP_056622.1
5'(3')-deoxyribonucleotidase, cytosolic type
Mus musculus
Gene Nt5c, UniProt Q9JM14
>NP_056622.1|Yersinia pseudotuberculosis IP 32953|5'(3')-deoxyribonucleotidase, cytosolic type
MAVKRPVRVLVDMDGVLADFESGLLQGFRRRFPEEPHVPLEQRRGFLANEQYGALRPDLAEKVASVYESPGFFLNLEPIPGALDALREMNDMKDTEVFICTTPLLKYDHCVGEKYRWVEQNLGPEFVERIILTRDKTVVMGDLLIDDKDNIQGLEETPSWEHILFTCCHNQHLALPPTRRRLLSWSDNWRGIIESKRASL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.84 | -0.843142096211289 | 0.033 | 28096329 | |
Retrieved 1 of 2 entries in 2.1 ms
(Link to these results)