Host taxon 10090
Protein NP_081127.1
39S ribosomal protein L52, mitochondrial precursor
Mus musculus
Gene Mrpl52, UniProt Q9D0Y8
>NP_081127.1|Yersinia pseudotuberculosis IP 32953|39S ribosomal protein L52, mitochondrial precursor
MAALGTWLSSVRRLHCSVVARAGGQWRLQQGLAANPSGYGPLTELPDWSFADGRPAPPMKGQLRRKAQREKLARRVVLLTQEMDAGIQAWKLRQQKLQEERKKEHDLKPKGTLLRSPLPNQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.88 | 0.878833232598461 | 0.0063 | 28096329 | |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)