Host taxon 10090
Protein NP_077189.2
39S ribosomal protein L28, mitochondrial
Mus musculus
Gene Mrpl28, UniProt Q9D1B9
>NP_077189.2|Yersinia pseudotuberculosis IP 32953|39S ribosomal protein L28, mitochondrial
MPLHRYPVHLWQKLRLRQGICARLPAHFLRSLEEERTPTPVHYKPHGTKFKINPKNGQRERVEDVPIPVHYPPESQQGLWGGEGLILGYRYANNDKLSKRVKKVWKPQLFTRELYSEILDKKFTVTVTMRTLDLIDEAYGFDFYILKTPKEDLGSKFGMDLKRGMLLRLARQDPHLHPENPERRAAIYDKYRSFVIPEAEAEWVGLTLEEALEKQRLLEEKDPVPLFKVYVEELVQRLQEQVLSRPAVVQKRAGDHA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.56 | -0.562098509030668 | 0.033 | 28096329 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)