Bacterial taxon 273123
Protein WP_002212190.1
3,4-dihydroxy-2-butanone-4-phosphate synthase
Yersinia pseudotuberculosis IP 32953
Gene ribB, UniProt Q665V6
>WP_002212190.1|Yersinia pseudotuberculosis IP 32953|3,4-dihydroxy-2-butanone-4-phosphate synthase
MNQTLLSDFGTPVERVERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITDERRQQLDLPMMVTHNSSQFQTAFTVTIEAAEGVTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQPGGVLSRRGHTEASIDLATLAGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVTIDDLAAYLQSRAKKAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.92 | 1.91995389760904 | 3.3e-9 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.67 | 1.67382069586078 | 1.7e-5 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.49 | 1.487104360605 | 2.1e-5 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.41 | 1.41187370429366 | 1.0e-7 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Retrieved 4 of 1 entries in 1 ms
(Link to these results)