Host taxon 10090
Protein NP_080356.1
28S ribosomal protein S24, mitochondrial isoform 1 precursor
Mus musculus
Gene Mrps24, UniProt Q9CQV5
>NP_080356.1|Yersinia pseudotuberculosis IP 32953|28S ribosomal protein S24, mitochondrial isoform 1 precursor
MAWSASVRGLGQRVLACSRELPGAWRTLHTSAVCAKNRAARVRVAKGNKPVSYEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTLEDVFLRKFMMGTFPGCLADQIVLKRRANQVDICALVLRQLPAHKFYFLVGYSETLLSHFYKCPVRLHLQTVPSKVVYKYI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.78 | -0.784856034833018 | 0.00043 | 28096329 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)