Host taxon 10090
Protein NP_001028485.1
28 kDa heat- and acid-stable phosphoprotein
Mus musculus
Gene Pdap1, UniProt Q3UHX2
>NP_001028485.1|Yersinia pseudotuberculosis IP 32953|28 kDa heat- and acid-stable phosphoprotein
MPKGGRKGGHKGRVRQYTSPEEIDAQLQAEKQKANEEDEQEEGGDGASGDPKKEKKSLDSDESEDEDDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.89 | 0.891043995968058 | 5.4e-7 | 28096329 | |
Retrieved 1 of 2 entries in 9.7 ms
(Link to these results)