Host taxon 10090
Protein NP_032304.2
15-hydroxyprostaglandin dehydrogenase [NAD(+)]
Mus musculus
Gene Hpgd, UniProt Q8VCC1
>NP_032304.2|Yersinia pseudotuberculosis IP 32953|15-hydroxyprostaglandin dehydrogenase [NAD(+)]
MHVNGKVALVTGAAQGIGKAFAEALLLHGAKVALVDWNLEAGVKCKAALDEQFEPQKTLFVQCDVADQKQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEQTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIIGFTRSAAMAANLMKSGVRLNVICPGFVDTPILESIEKEENMGQYIEYKDQIKAMMKFYGVLHPSTIANGLINLIEDDALNGAIMKITASKGIHFQDYDISPLLVKAPLTS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ -3.64 | -3.63884520968482 | 4.1e-49 | 28096329 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)