Bacterial taxon 1314
Protein WP_002987746.1
type Z 30S ribosomal protein S14
Streptococcus pyogenes
Gene rpsN, UniProt A0A4Q1Q021
>WP_002987746.1|Streptococcus pyogenes|type Z 30S ribosomal protein S14
MAKKSMIAKNKRPAKHSTQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVVKASW
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●●○○○ -1.36 | -1.36008675343258 | 3.8e-15 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)