Bacterial taxon 1314
Protein WP_002982773.1
type A2 lantipeptide
Streptococcus pyogenes
Gene salA1, UniProt Q38L38
>WP_002982773.1|Streptococcus pyogenes|type A2 lantipeptide
MSFMKNSKDILTNAIEEVSEKELMEVAGGKKGSGWFATITDDCPNSVFVCC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●●○○○ 1.38 | 1.38313951596208 | 0.011 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)