Bacterial taxon 1314
Protein WP_002985285.1
TOMM family cytolysin streptolysin S
Streptococcus pyogenes
Gene sagA, UniProt O69194
>WP_002985285.1|Streptococcus pyogenes|TOMM family cytolysin streptolysin S
MLKFTSNILATSVAETTQVAPGGCCCCCTTCCFSIATGSGNSQGGSGSYTPGK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●●●●● 6 | 6.00366841342228 | 8.3e-86 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)