Bacterial taxon 1314
Protein WP_002990295.1
metal-sulfur cluster assembly factor
Streptococcus pyogenes
Gene n/a, UniProt A0A4U7GPW7
>WP_002990295.1|Streptococcus pyogenes|metal-sulfur cluster assembly factor
MSDTPKYTQDQVIAIKNRILEALETVIDPELGIDVVNLGLIYEIRFNDNGYTEIDMTLTTMGCPLADLLTDYIHDALQDVPEVTKTEVKLVWYPAWTVDKMSRYARIALGIR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●○○○○ -0.87 | -0.869203016651828 | 0.00095 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)