Bacterial taxon 1314
Protein WP_002990299.1
large conductance mechanosensitive channel protein MscL
Streptococcus pyogenes
Gene mscL, UniProt A0A4U7I8N7
>WP_002990299.1|Streptococcus pyogenes|large conductance mechanosensitive channel protein MscL
MVKELKAFLFRGNIIELAVAVIIGGAFGAIVTSFVNDIITPLILNPALKAANVENITQLSWNGVKYGSFLGAVINFLIIGTSLFFVVKAAEKAMPKKEKEAAAPTQEELLTEIRDLLAQK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●●●○○ 2.65 | 2.64754384527251 | 3.5e-11 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)