Bacterial taxon 1314
Protein WP_002984803.1
lantibiotic streptin
Streptococcus pyogenes
Gene srtA_1, UniProt A0A4Q1Q3F4
>WP_002984803.1|Streptococcus pyogenes|lantibiotic streptin
MNNTIKDFDLDLKTNKKDTATPYVGSRYLCTPGSCWKLVCFTTTVK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●●○○○ 1.62 | 1.6184197361039 | 0.024 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)