Bacterial taxon 1314
Protein WP_002983920.1
HU family DNA-binding protein
Streptococcus pyogenes
Gene hupB, UniProt A0A4U7I2R3
>WP_002983920.1|Streptococcus pyogenes|HU family DNA-binding protein
MANKQDLIAKVAEATELTKKDSAAAVDAVFSTIEAFLAEGEKVQLIGFGNFEVRERAARKGRNPQTGAEIEIAASKVPAFKAGKALKDAVK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●○○○○ -0.49 | -0.487201844898667 | 0.0055 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)