Bacterial taxon 1314
Protein WP_002985249.1
F0F1 ATP synthase subunit C
Streptococcus pyogenes
Gene atpE, UniProt A0A4U9IHK2
>WP_002985249.1|Streptococcus pyogenes|F0F1 ATP synthase subunit C
MNPIFALALACFGVSLAEGFLMANLFKAASRQPEIIGQLRSLMILGVAFIEGTFFVTLVMAFILK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●●●○○ -2.81 | -2.81099868018368 | 9.1e-16 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)