Bacterial taxon 1314
Protein WP_009880256.1
DUF5072 family protein
Streptococcus pyogenes
Gene n/a, UniProt A0A4U7IQD7
>WP_009880256.1|Streptococcus pyogenes|DUF5072 family protein
MLKKLGLVDLHASIKQKIEDKTGLMAYDHVPEDMPSPFYFIEVVDKRPEDTKVMWCEVFTVWIHAIAEAGKSKIAIYDMIEKLEEALTEELVLPEEIDILRQSEVGMQSLQEDETGEMHAIVAYEIKVSYGFKVKV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●●●●○ 3.17 | 3.17359709639817 | 0.045 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)