Bacterial taxon 1314
Protein WP_002985011.1
DUF1149 family protein
Streptococcus pyogenes
Gene n/a, UniProt A0A4U7HAG1
>WP_002985011.1|Streptococcus pyogenes|DUF1149 family protein
MQLVREKEFVNQYHYDARNLEWEKENGTPETNFEVTFQLIDKDEQQKETVIVSVLQFVIVKEEFVISGVISQMVRILDRLVDKPSEFTQEEVESLAAPLLDMVKRLTYEVTEIALDRPGIHLEFKN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●●○○○ 1.55 | 1.55429318862441 | 2.5e-7 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)