Bacterial taxon 1314
Protein WP_002990099.1
dTDP-4-dehydrorhamnose 3,5-epimerase
Streptococcus pyogenes
Gene rmlC, UniProt A0A4U9IEF1
>WP_002990099.1|Streptococcus pyogenes|dTDP-4-dehydrorhamnose 3,5-epimerase
MTETFFDKPLACREIKEIPGLLEFDIPVRGDNRGWFKENFQKEKMLPIGFPERFFEEGKLQNNVSFSRQHVLRGLHAEPWDKYISVADDGKVLGAWVDLREGETFGNVYQTVIDASKGMFVPRGVANGFQVLSETVSYSYLVNDYWALDLKPKYAFVNYADPSLGITWENLAAAEVSEADKNHPLLSDVKPLKPKDL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●●○○○ -1.66 | -1.66424869664604 | 8.6e-18 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)