Bacterial taxon 1314
Protein WP_010922120.1
DNA-directed RNA polymerase subunit beta
Streptococcus pyogenes
Gene epuA, UniProt A0A4Q1PUY8
>WP_010922120.1|Streptococcus pyogenes|DNA-directed RNA polymerase subunit beta
MTNGLKYVLEQMLLLFIIAALACLFLAIGLMIGYSFMGDGQSPWHILSMDKWAELVNKFTGK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●●○○○ -1.1 | -1.10046157308067 | 0.0066 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)