Bacterial taxon 1314
Protein WP_002990257.1
bifunctional folylpolyglutamate synthase/dihydrofolate synthase
Streptococcus pyogenes
Gene folC2, UniProt A0A4U7HJ80
>WP_002990257.1|Streptococcus pyogenes|bifunctional folylpolyglutamate synthase/dihydrofolate synthase
MTTYDSISWIHTFKANGRKTDLARMAWLLEALGRPQDKFPAIHVVGTNGKGSVTAYLQHILSTSGYQVGTFTSPFIISFHDRICLNGQPISDLELAQCVSVIRPILTKMSLETNWDRPTEFELVTLIMFCYFANLKPVDIAIIEAGIGGKTDATNVFHALAVVCPSISFDHQERLGYSLAEIAHQKAEVIKAKEPVIIGQLEQEASQVFQQVTQKAGSRLYQLGKDFLLNPSEKTFSFQHDNLNLTKLRLKLLGQHQKANACLAIMTAQLLRKSFPKISPKTIQKGIEATTWPGRSEFIQPNLLLDGAHNPDSIAKLKSLLQEEFPKRPIHILFAGLKRKPLADLLAQLDTFEVSVTTFDFPEANLLEDYPDKYPQVKDYRDWLQGSVTSDELFVVTGSLYFISEVRQYCLSNANIFKNIFP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●●○○○ -1.56 | -1.55857909489429 | 0.00037 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)