Bacterial taxon 1314
Protein WP_002985149.1
50S ribosomal protein L20
Streptococcus pyogenes
Gene rplT, UniProt A0A4Q1PWD3
>WP_002985149.1|Streptococcus pyogenes|50S ribosomal protein L20
MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKLWITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVADAAAFTALADAAKAKLGK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●●○○○ -1.94 | -1.93829844359143 | 3.1e-10 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)