Bacterial taxon 1314
Protein WP_002983117.1
30S ribosomal protein S6
Streptococcus pyogenes
Gene rpsF, UniProt A0A4U7IWQ5
>WP_002983117.1|Streptococcus pyogenes|30S ribosomal protein S6
MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEINDFREGLYHIVNLEATDAAALNEFDRLSKINGDILRHMIVKLDA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●○○○○ -0.65 | -0.648867740820611 | 0.0066 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)